PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001139
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 159aa    MW: 17110.9 Da    PI: 9.8708
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001139genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26072.11.1e-222073154
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeer 54
                 +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll + ++ ++
  Lus10001139 20 PCAACKFLRRKCLPDCIFAPYFPPEEPHKFANVHKIFGASNVSKLLIQGKQRQQ 73
                 7*********************************************98665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.0119120IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-222074IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MAGNSSSSSS TTSNNYTNSP CAACKFLRRK CLPDCIFAPY FPPEEPHKFA NVHKIFGASN  60
VSKLLIQGKQ RQQAAQRGPP ASEGGRSQLA GLRGRGEAQG PGLRLRWSYL SPRETEASRM  120
NPIYDHHQQG YYGNYSSWNN NNCGGDHGQG RGSGGGGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8841271e-74HQ884127.1 Linum usitatissimum clone Contig1437 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554815.18e-34PREDICTED: LOB domain-containing protein 25-like
RefseqXP_006603773.18e-34PREDICTED: LOB domain-containing protein 25-like
RefseqXP_006603775.18e-34PREDICTED: LOB domain-containing protein 25-like
RefseqXP_014626970.18e-34PREDICTED: LOB domain-containing protein 25-like
RefseqXP_014626971.18e-34PREDICTED: LOB domain-containing protein 25-like
TrEMBLA0A0B2QV338e-34A0A0B2QV33_GLYSO; LOB domain-containing protein 25
TrEMBLK7MVP68e-34K7MVP6_SOYBN; Uncharacterized protein
STRINGGLYMA19G00390.22e-33(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-27LBD family protein